PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009800139.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 751aa    MW: 81059.8 Da    PI: 7.1262
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009800139.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1452.3e-14271328562
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     kr  r+++NRe+A+ sRqRKk ++eeLe+kv ++ +  ++L  +++ +  e a+l+s+
  XP_009800139.1 271 KRKARLMRNRESAQLSRQRKKHYVEELEDKVRTMHSTIQDLNAKISYIMSENATLRSQ 328
                     999**************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-15267331IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714269332IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.5E-12271329No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-16271329No hitNo description
PfamPF001702.4E-12271328IPR004827Basic-leucine zipper domain
CDDcd147048.08E-21272323No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MANPLEADPY VPPANDFAGA LDPPLDQGNS NNSSNSICDE AFNNEFMFDD LDFDLDIIFP  60
PDDAAILNNS NSLEAGQIDP KGFGHQLIQG FNDSSRVFKS SPELRHVSVA GGTSEACHSS  120
GGQASSGSLV MTAVSNQISD VSGYLNVPSP PESNGSNHED SGNDSKEGSH DSNCPSPESQ  180
GSGNCGSHVS EEAFNYPSKS VTSSPIKCVV VVEQNIIKLE EMMNTKDNKC SSILKRKKVS  240
EEDSNNVSKY QKSNYVAECS NVFNSEGGDE KRKARLMRNR ESAQLSRQRK KHYVEELEDK  300
VRTMHSTIQD LNAKISYIMS ENATLRSQMG PVPSQMPPPP PGMYPVMYPW MPCAPPYMVK  360
PQGSQVPLVP IPRLKPQAAA PAPKGSKKVE IKKSEMKTKK VASVSFLGLL FFMLLFGGLV  420
PVINMRYGGV REPFTSGDLS GSGHNERHRG RVLAVDGQVN GSSYSRKHNG RDYGTNCGRR  480
GQGGDGQPNF NSGTDEFVRS GNDSEPLMAS LYVPRNDKLV KIDGNLIIHS VLASEKAMAS  540
HRSEDKKNRG ETGLAVPGDL APAIPGRHSH HYRSPTDGKR ALGSGDKEKA KSTVQQWFLE  600
GVAEPMLSSG MCTEVFQFDV SSSPGGIVPV TTARNVSMKQ RQNATTRTNK GRNRRILNSL  660
SVPVSGVTHS ISEEHVGGSG KNDDFTGNNS LSSMVVSVLV DPREAGDADG DGMMGPKSIS  720
RIFVVVLIDS VKYVTYSCML PFKGSVPLVT T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009800139.10.0PREDICTED: uncharacterized protein LOC104246095
RefseqXP_016458716.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLM1AAQ50.0M1AAQ5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000184860.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30292450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-130bZIP family protein